PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DL_3CE000E38.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 242aa    MW: 26600 Da    PI: 4.7596
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DL_3CE000E38.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.96.6e-1182133455
                            XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                            +k+ rr ++NR +A +sR+RKk +++ Le+k+k Leae ++L   l+    e
  Traes_7DL_3CE000E38.1  82 SKKKRRQMRNRDSAMKSRERKKSYVKDLETKSKYLEAECRRLSYALQCCAAE 133
                            699************************************9998777665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-678143IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.73781123IPR004827Basic-leucine zipper domain
PfamPF001707.5E-1083139IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-1183141No hitNo description
Gene3DG3DSA:1.20.5.1703.1E-1283142No hitNo description
CDDcd147048.76E-1484135No hitNo description
PROSITE patternPS00036086101IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MQEEEAAGAE PVDGISVDEF LDTLFDGAEE GGEKGNGSEA EAGGSTDGDS RRGEDGVEVV  60
TPETEAEVVT PETEVDGDDP ISKKKRRQMR NRDSAMKSRE RKKSYVKDLE TKSKYLEAEC  120
RRLSYALQCC AAENMALRQN MLKDRPIGAH TAMQESAVLS ETLPLVSLLW LVSIVCLFLT  180
PGLPNRSLVA PRRAERDLAM VAGKPSSDQP ETLELLLHGR RWRGTRERIK LDTPPLRAAA  240
AC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18286KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3655050.0AK365505.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034K24.
GenBankAK3699570.0AK369957.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2101P04.
GenBankAK3701490.0AK370149.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2105L10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563606.11e-111PREDICTED: bZIP transcription factor 60
TrEMBLW5HYX31e-177W5HYX3_WHEAT; Uncharacterized protein
STRINGMLOC_22013.11e-157(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69343750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.18e-15basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]